Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLK2 Rabbit Polyclonal Antibody (Biotin)

CLK2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CLK2

UniProt

P49760

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLK2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVN

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_005276799

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Interleukin-13 IL13 Antibody Picoband®, FITC Conjugate
PA1701-FITC 100 µg/Vial

Anti-Interleukin-13 IL13 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Phospho-p53 (Ser15) (16G8) Mouse Monoclonal Antibody (Alexa Fluor® 488 Conjugate)
CST 9235S 100 µL

Phospho-p53 (Ser15) (16G8) Mouse Monoclonal Antibody (Alexa Fluor® 488 Conjugate)

Sign In for Pricing
View Details
Semaphorin 7A (Semaphorin-7A, SEMA7A, CD108, CDw108, JMH Blood Group Antigen, John-Milton-Hargen Human Blood Group Ag, JMH, Semaphorin-K1, Sema K1, SEMAK1, Semaphorin-L, Sema L, SEMAL) (MaxLight 490)
MBS6203202-01 0.1 mL

Semaphorin 7A (Semaphorin-7A, SEMA7A, CD108, CDw108, JMH Blood Group Antigen, John-Milton-Hargen Human Blood Group Ag, JMH, Semaphorin-K1, Sema K1, SEMAK1, Semaphorin-L, Sema L, SEMAL) (MaxLight 490)

Sign In for Pricing
View Details
Semaphorin 7A (Semaphorin-7A, SEMA7A, CD108, CDw108, JMH Blood Group Antigen, John-Milton-Hargen Human Blood Group Ag, JMH, Semaphorin-K1, Sema K1, SEMAK1, Semaphorin-L, Sema L, SEMAL) (MaxLight 490)
MBS6203202-02 5x 0.1 mL

Semaphorin 7A (Semaphorin-7A, SEMA7A, CD108, CDw108, JMH Blood Group Antigen, John-Milton-Hargen Human Blood Group Ag, JMH, Semaphorin-K1, Sema K1, SEMAK1, Semaphorin-L, Sema L, SEMAL) (MaxLight 490)

Sign In for Pricing
View Details
Closantel Sodium
S4105-50mg 50 mg

Closantel Sodium

Sign In for Pricing
View Details
RB1 antibody - middle region
MBS3213723-01 0.1 mL

RB1 antibody - middle region

Sign In for Pricing
View Details