Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLK2 Rabbit Polyclonal Antibody (Biotin)

CLK2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

B7Z8N6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human CLK2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001281268.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Saccharomyces cerevisiae Elp3 Antibody Fluoro488 Conjugated
DZ41382-Fluoro488 200 µL/Vial

Anti-Saccharomyces cerevisiae Elp3 Antibody Fluoro488 Conjugated

Sign In for Pricing
View Details
Lentiviral human HOXA7 shRNA (UAS) - Lentiviral human HOXA7 shRNA (UAS, RFP) (25)
GTR15157091 1 Vial

Lentiviral human HOXA7 shRNA (UAS) - Lentiviral human HOXA7 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Anti-Zebrafish Glucocorticoid receptor/NR3C1 Antibody Picoband® Fluoro647 Conjugated
AZQ1XHK0-Fluoro647 100 µg/Vial

Anti-Zebrafish Glucocorticoid receptor/NR3C1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
TAZ Rabbit Polyclonal Antibody (BF594)
orb1581161 100 µL

TAZ Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Horse A Disintegrin and Metalloproteinase With Thrombospondin 7 ELISA Kit
MBS083153-01 48 Well

Horse A Disintegrin and Metalloproteinase With Thrombospondin 7 ELISA Kit

Sign In for Pricing
View Details
Horse A Disintegrin and Metalloproteinase With Thrombospondin 7 ELISA Kit
MBS083153-02 96 Well

Horse A Disintegrin and Metalloproteinase With Thrombospondin 7 ELISA Kit

Sign In for Pricing
View Details