Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif4ebp1 Rabbit Polyclonal Antibody (Biotin)

Eif4ebp1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PH, 4e-bp, 4e-bp1, PHAS-I, AA959816

UniProt

Q60876

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTP

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031944

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gcnt1 qPCR Primer Pair
QM13646S 200 Tests

Mouse Gcnt1 qPCR Primer Pair

Sign In for Pricing
View Details
Protein Phosphatase 1 beta (PP1 beta catalytic subunit, pp1b) (Biotin)
P9107-15B-Biotin 100 µL

Protein Phosphatase 1 beta (PP1 beta catalytic subunit, pp1b) (Biotin)

Sign In for Pricing
View Details
TCL6, CT (TCL6, TNG1, TNG2, Putative T-cell leukemia/lymphoma protein 6, TCL1 neighboring gene 1 protein) (PE) discontinued
042704-PE 200 µL

TCL6, CT (TCL6, TNG1, TNG2, Putative T-cell leukemia/lymphoma protein 6, TCL1 neighboring gene 1 protein) (PE) discontinued

Sign In for Pricing
View Details
mmu-miR-6914-3p miRNA Mimic
MBS8301930-01 5 nmol

mmu-miR-6914-3p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-6914-3p miRNA Mimic
MBS8301930-02 10 nmol

mmu-miR-6914-3p miRNA Mimic

Sign In for Pricing
View Details
mmu-miR-6914-3p miRNA Mimic
MBS8301930-03 5x 10 nmol

mmu-miR-6914-3p miRNA Mimic

Sign In for Pricing
View Details