Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif4ebp1 Rabbit Polyclonal Antibody (HRP)

Eif4ebp1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PH, 4e-bp, 4e-bp1, PHAS-I, AA959816

UniProt

Q60876

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVAKTP

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031944

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI3 Kinase p110 Delta/PIK3CD Antibody Cy3 Conjugated
orb3167845 100 µg

PI3 Kinase p110 Delta/PIK3CD Antibody Cy3 Conjugated

Sign In for Pricing
View Details
Anti-Human CLDN11 Polyclonal Antibody
ARO-A11361-01 50 µg

Anti-Human CLDN11 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human CLDN11 Polyclonal Antibody
ARO-A11361-02 100 µg

Anti-Human CLDN11 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human CLDN11 Polyclonal Antibody
ARO-A11361-03 1 mg

Anti-Human CLDN11 Polyclonal Antibody

Sign In for Pricing
View Details
CD68 (human) monoclonal antibody (KP1)
ENZ-ABS150-0100 100 µg

CD68 (human) monoclonal antibody (KP1)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Antiholin-like protein LrgA (lrgA)
orb2921100-01 20 µg

Recombinant Staphylococcus aureus Antiholin-like protein LrgA (lrgA)

Sign In for Pricing
View Details