Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif4ebp2 Rabbit Polyclonal Antibody (FITC)

Eif4ebp2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PH, 4E-BP, 4E-BP2, PHAS-II, AA792569, BC010348, 2810011I19Rik

UniProt

P70445

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GSHQPSQSRAIPTRTVAISDAAQLPQDYCTTPGGTLFSTTPGGTRIIYDR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034254

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal HR6A/UBE2A Antibody [Alexa Fluor 647]
NB100-554AF647 0.1 mL

Rabbit Polyclonal HR6A/UBE2A Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
STK19 siRNA (Mouse)
CRM5514-01 15 nmol

STK19 siRNA (Mouse)

Sign In for Pricing
View Details
STK19 siRNA (Mouse)
CRM5514-02 30 nmol

STK19 siRNA (Mouse)

Sign In for Pricing
View Details
ZFP57 Recombinant Protein (Rat)
RP238463 100 µg

ZFP57 Recombinant Protein (Rat)

Sign In for Pricing
View Details
SRY CRISPR All-in-one AAV vector set (with saCas9)(Human)
45527151 3x 1.0 µg DNA

SRY CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Delta-like Protein 1, Recombinant, Human (DLL1, Delta-like 1, Delta1, DL1, H-Delta-1, UNQ146/PRO172)
D2727-73 50 µg

Delta-like Protein 1, Recombinant, Human (DLL1, Delta-like 1, Delta1, DL1, H-Delta-1, UNQ146/PRO172)

Sign In for Pricing
View Details