Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNN2 Rabbit Polyclonal Antibody (HRP)

CNN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q99439

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CNN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004359

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal MARCH8 Antibody
APR06511G 0.1 mg

Polyclonal MARCH8 Antibody

Sign In for Pricing
View Details
ALKBH7 Protein Vector (Human) (pPM-N-D-C-His)
PV321345 500 ng

ALKBH7 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Rabbit Fatty Acid Binding Protein 4, Adipocyte ELISA kit
GTR10454154 96 Well

Rabbit Fatty Acid Binding Protein 4, Adipocyte ELISA kit

Sign In for Pricing
View Details
ATXN10 (Ataxin 10, E46L, SCA10, HUMEEP) (MaxLight 405)
MBS6407889-01 0.1 mL

ATXN10 (Ataxin 10, E46L, SCA10, HUMEEP) (MaxLight 405)

Sign In for Pricing
View Details
ATXN10 (Ataxin 10, E46L, SCA10, HUMEEP) (MaxLight 405)
MBS6407889-02 5x 0.1 mL

ATXN10 (Ataxin 10, E46L, SCA10, HUMEEP) (MaxLight 405)

Sign In for Pricing
View Details
GEM Antibody - N-terminal region : Biotin (ARP42225_P050-Biotin)
ARP42225_P050-Biotin 100 µL

GEM Antibody - N-terminal region : Biotin (ARP42225_P050-Biotin)

Sign In for Pricing
View Details