Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK1G3 Rabbit Polyclonal Antibody (HRP)

CSNK1G3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CSNK1G3L, CKI-gamma 3

UniProt

Q9Y6M4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CSNK1G3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001038187

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pure Canavalia ensiformis Lectin (Jackbean) -Con A-
L-1104-1g 1 mg

Pure Canavalia ensiformis Lectin (Jackbean) -Con A-

Sign In for Pricing
View Details
PRDM1 Human Gene Knockout Kit (CRISPR)
KN217363BN 1 Kit

PRDM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rab3gap2 Mouse Gene Knockout Kit (CRISPR)
KN514368 1 Kit

Rab3gap2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ACADM Rabbit Monoclonal Antibody [Clone ID: R06-8F7]
TA383650 100 µL

ACADM Rabbit Monoclonal Antibody [Clone ID: R06-8F7]

Sign In for Pricing
View Details
Uncoated Human GNLY (Granulysin) ELISA Kit
E-UNEL-H0305-01 5x 96 Tests

Uncoated Human GNLY (Granulysin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human GNLY (Granulysin) ELISA Kit
E-UNEL-H0305-02 15x 96 Tests

Uncoated Human GNLY (Granulysin) ELISA Kit

Sign In for Pricing
View Details