Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK1G3 Rabbit Polyclonal Antibody (HRP)

CSNK1G3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CSNK1G3L, CKI-gamma 3

UniProt

Q9Y6M4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CSNK1G3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001038187

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UQCRQ activation kit by CRISPRa
GA109000 1 Kit

Human UQCRQ activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS509701 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
ETFA (NM_001127716) Human Over-expression Lysate
LY426873 100 µg

ETFA (NM_001127716) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabies (Rab-50), CF568 conjugate, 0.1mg/mL
BNC680943-100 1x 100 µL

Rabies (Rab-50), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Genomic DNA, Breast
CD564081 5 µg

Tissue Genomic DNA, Breast

Sign In for Pricing
View Details
Tissue Total RNA, Soft tissue
CR561803 5 µg

Tissue Total RNA, Soft tissue

Sign In for Pricing
View Details