Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTTN Rabbit Polyclonal Antibody (FITC)

CTTN Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EMS1

UniProt

Q8N707

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CTTN

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005222

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2R3C, NT (PPP2R3C, C14orf10, G5PR, Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma, Protein phosphatase subunit G5PR, Rhabdomyosarcoma antigen MU-RMS-40.6A/6C) (MaxLight 405)
MBS6330180-01 0.1 mL

P2R3C, NT (PPP2R3C, C14orf10, G5PR, Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma, Protein phosphatase subunit G5PR, Rhabdomyosarcoma antigen MU-RMS-40.6A/6C) (MaxLight 405)

Sign In for Pricing
View Details
P2R3C, NT (PPP2R3C, C14orf10, G5PR, Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma, Protein phosphatase subunit G5PR, Rhabdomyosarcoma antigen MU-RMS-40.6A/6C) (MaxLight 405)
MBS6330180-02 5x 0.1 mL

P2R3C, NT (PPP2R3C, C14orf10, G5PR, Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma, Protein phosphatase subunit G5PR, Rhabdomyosarcoma antigen MU-RMS-40.6A/6C) (MaxLight 405)

Sign In for Pricing
View Details
SEC11C Protein, Human, Recombinant (His & SUMO)
TMPH-02110-01 5 µg

SEC11C Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details
SEC11C Protein, Human, Recombinant (His & SUMO)
TMPH-02110-02 10 µg

SEC11C Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details
SEC11C Protein, Human, Recombinant (His & SUMO)
TMPH-02110-03 20 µg

SEC11C Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details
SEC11C Protein, Human, Recombinant (His & SUMO)
TMPH-02110-04 50 µg

SEC11C Protein, Human, Recombinant (His & SUMO)

Sign In for Pricing
View Details