Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTTN Rabbit Polyclonal Antibody (HRP)

CTTN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EMS1

UniProt

Q14247

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CTTN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_612632

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Human CD38 Flow Cytometry Monoclonal Clone HIT2 AF488 Ready To Use 200 Tests
IMSAHUCD38HIT2CAF488200 200 Tests

Anti Human CD38 Flow Cytometry Monoclonal Clone HIT2 AF488 Ready To Use 200 Tests

Sign In for Pricing
View Details
ALS2CL Protein Vector (Human) (pPB-His-MBP)
PV321446 500 ng

ALS2CL Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
Treacle (Treacle Protein, Treacher Collins Syndrome Protein, TCOF1) discontinued
226444-01 50 µL

Treacle (Treacle Protein, Treacher Collins Syndrome Protein, TCOF1) discontinued

Sign In for Pricing
View Details
Treacle (Treacle Protein, Treacher Collins Syndrome Protein, TCOF1) discontinued
226444-02 100 µL

Treacle (Treacle Protein, Treacher Collins Syndrome Protein, TCOF1) discontinued

Sign In for Pricing
View Details
IFNGR2 (Biotin)
565396-01 50 µg

IFNGR2 (Biotin)

Sign In for Pricing
View Details
IFNGR2 (Biotin)
565396-02 100 µg

IFNGR2 (Biotin)

Sign In for Pricing
View Details