Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP1M2 Rabbit Polyclonal Antibody (HRP)

AP1M2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mu2, MU1B, MU-1B, HSMU1B, AP1-mu2

UniProt

Q9Y6Q5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human AP1M2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005489

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp157 Immunizing Peptide
MBS427771-01 0.1 mg

Zfp157 Immunizing Peptide

Sign In for Pricing
View Details
Zfp157 Immunizing Peptide
MBS427771-02 5x 0.1 mg

Zfp157 Immunizing Peptide

Sign In for Pricing
View Details
25MTR Tubing Versilic 7x25Mm BxO D
TUB19720 25 m

25MTR Tubing Versilic 7x25Mm BxO D

Sign In for Pricing
View Details
RUNDC1, CT (RUNDC1, RUN domain-containing protein 1) (PE)
MBS6344424-01 0.2 mL

RUNDC1, CT (RUNDC1, RUN domain-containing protein 1) (PE)

Sign In for Pricing
View Details
RUNDC1, CT (RUNDC1, RUN domain-containing protein 1) (PE)
MBS6344424-02 5x 0.2 mL

RUNDC1, CT (RUNDC1, RUN domain-containing protein 1) (PE)

Sign In for Pricing
View Details
Fish Lipoprotein lipase, LPL GENLISA ELISA
KLF0093 96 Well

Fish Lipoprotein lipase, LPL GENLISA ELISA

Sign In for Pricing
View Details