Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDIL3 Rabbit Polyclonal Antibody (HRP)

EDIL3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DEL1

UniProt

O43854

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EDIL3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005702

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ly6g6d Rat shRNA Lentiviral Particle (Locus ID 415062)
TL700431V 500 µL Each

Ly6g6d Rat shRNA Lentiviral Particle (Locus ID 415062)

Sign In for Pricing
View Details
TLX1, ID (TLX1, HOX11, TCL3, T-cell leukemia homeobox protein 1, Homeobox protein Hox-11, Proto-oncogene TCL-3, T-cell leukemia/lymphoma protein 3) (AP) discontinued
042885-AP 200 µL

TLX1, ID (TLX1, HOX11, TCL3, T-cell leukemia homeobox protein 1, Homeobox protein Hox-11, Proto-oncogene TCL-3, T-cell leukemia/lymphoma protein 3) (AP) discontinued

Sign In for Pricing
View Details
DGKE Protein Vector (Human) (pPM-C-His)
PV051348 500 ng

DGKE Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
TET-dT Phosphoramidite
6212-AAT 50 µmole

TET-dT Phosphoramidite

Sign In for Pricing
View Details
2-Pentylpyrrolidine hydrochloride
ZEC60402-01 50 mg

2-Pentylpyrrolidine hydrochloride

Sign In for Pricing
View Details
2-Pentylpyrrolidine hydrochloride
ZEC60402-02 0.5 g

2-Pentylpyrrolidine hydrochloride

Sign In for Pricing
View Details