Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARPC3 Rabbit Polyclonal Antibody (HRP)

ARPC3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARC21, p21-Arc

UniProt

O15145

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ARPC3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFK

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005710

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFAP (Ser38) polyclonal antibody
AP0227-01 50 µL

GFAP (Ser38) polyclonal antibody

Sign In for Pricing
View Details
GFAP (Ser38) polyclonal antibody
AP0227-02 100 µL

GFAP (Ser38) polyclonal antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CD299 Polyclonal Antibody
PA85098HU-01 50 µg

Rabbit Anti-Human CD299 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CD299 Polyclonal Antibody
PA85098HU-02 100 µg

Rabbit Anti-Human CD299 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CD299 Polyclonal Antibody
PA85098HU-03 500 µg

Rabbit Anti-Human CD299 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CD299 Polyclonal Antibody
PA85098HU-04 1 mg

Rabbit Anti-Human CD299 Polyclonal Antibody

Sign In for Pricing
View Details