Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARPC3 Rabbit Polyclonal Antibody (Biotin)

ARPC3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARC21, p21-Arc

UniProt

O15145

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARPC3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005710

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Intercellular Adhesion Molecule 2 (ICAM2) Antibody Pair Kit (with Standard)
MBS2099069-01 5x 96 Tests

Rat Intercellular Adhesion Molecule 2 (ICAM2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Intercellular Adhesion Molecule 2 (ICAM2) Antibody Pair Kit (with Standard)
MBS2099069-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Intercellular Adhesion Molecule 2 (ICAM2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Intercellular Adhesion Molecule 2 (ICAM2) Antibody Pair Kit (with Standard)
MBS2099069-03 10x 96 Tests

Rat Intercellular Adhesion Molecule 2 (ICAM2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Intercellular Adhesion Molecule 2 (ICAM2) Antibody Pair Kit (with Standard)
MBS2099069-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Rat Intercellular Adhesion Molecule 2 (ICAM2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat LOC120095955 Pre-designed siRNA Set A
SI207708A 1 Each

Rat LOC120095955 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Amplirun® Total SARS-CoV-2 Control (Swab)
N15-MBTC030 10 Vials

Amplirun® Total SARS-CoV-2 Control (Swab)

Sign In for Pricing
View Details