Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARPC3 Rabbit Polyclonal Antibody (FITC)

ARPC3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ARC21, p21-Arc

UniProt

O15145

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARPC3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005710

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Cytochrome P450 5A1 Antibody
MBS4511378-01 0.05 mL

Rabbit anti-Cytochrome P450 5A1 Antibody

Sign In for Pricing
View Details
Rabbit anti-Cytochrome P450 5A1 Antibody
MBS4511378-02 0.1 mL

Rabbit anti-Cytochrome P450 5A1 Antibody

Sign In for Pricing
View Details
Rabbit anti-Cytochrome P450 5A1 Antibody
MBS4511378-03 5x 0.1 mL

Rabbit anti-Cytochrome P450 5A1 Antibody

Sign In for Pricing
View Details
Chmp7 3'UTR Luciferase Stable Cell Line
TU103849 1.0 mL

Chmp7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Slc3a2 shRNA (UAS) - Lentiviral mouse Slc3a2 shRNA (UAS, RFP) plasmid
GTR15304396 1 Vial

Lentiviral mouse Slc3a2 shRNA (UAS) - Lentiviral mouse Slc3a2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Anti-POLA1 Antibody Picoband® (Dylight488 Conjugate)
A04421-1-Dylight488 100 µg

Anti-POLA1 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details