Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dcaf7 Rabbit Polyclonal Antibody (Biotin)

Dcaf7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Wdr6, HAN11, Wdr68, C86529, 1700012F10Rik, 2610037L01Rik

UniProt

P61963

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_082222

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POFUT1 (GDP-fucose Protein O-fucosyltransferase 1, Peptide-O-fucosyltransferase 1, O-FucT-1, FUT12, KIAA0180, MGC2482) (HRP)
131553-HRP 100 µL

POFUT1 (GDP-fucose Protein O-fucosyltransferase 1, Peptide-O-fucosyltransferase 1, O-FucT-1, FUT12, KIAA0180, MGC2482) (HRP)

Sign In for Pricing
View Details
GBX2 (Homeobox Protein GBX-2, Gastrulation and Brain-specific Homeobox Protein 2) (MaxLight 405) discontinued
127213-ML405 100 µL

GBX2 (Homeobox Protein GBX-2, Gastrulation and Brain-specific Homeobox Protein 2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
CMTM3 Antibody
MBS7127227-01 0.05 mL

CMTM3 Antibody

Sign In for Pricing
View Details
CMTM3 Antibody
MBS7127227-02 0.1 mL

CMTM3 Antibody

Sign In for Pricing
View Details
CMTM3 Antibody
MBS7127227-03 5x 0.1 mL

CMTM3 Antibody

Sign In for Pricing
View Details
Pom121 3'UTR Luciferase Stable Cell Line
TU116703 1.0 mL

Pom121 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details