Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dcaf7 Rabbit Polyclonal Antibody (HRP)

Dcaf7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Wdr6, HAN11, Wdr68, C86529, 1700012F10Rik, 2610037L01Rik

UniProt

P61963

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_082222

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human Fibulin-1
P2316 100 µg

Recombinant human Fibulin-1

Sign In for Pricing
View Details
FAM185A Antibody Blocking peptide
orb1460456 500 µg

FAM185A Antibody Blocking peptide

Sign In for Pricing
View Details
Amyloid Precursor Protein (APP) Mouse Monoclonal Antibody [Clone ID: LBI6F11]
AMM12881VCF 100 µg

Amyloid Precursor Protein (APP) Mouse Monoclonal Antibody [Clone ID: LBI6F11]

Sign In for Pricing
View Details
Polyclonal Antibody to Islet Cell Autoantigen 1 (ICA1)
TRV-0044230-01 20 µL

Polyclonal Antibody to Islet Cell Autoantigen 1 (ICA1)

Sign In for Pricing
View Details
Polyclonal Antibody to Islet Cell Autoantigen 1 (ICA1)
TRV-0044230-02 100 µL

Polyclonal Antibody to Islet Cell Autoantigen 1 (ICA1)

Sign In for Pricing
View Details
Polyclonal Antibody to Islet Cell Autoantigen 1 (ICA1)
TRV-0044230-03 200 µL

Polyclonal Antibody to Islet Cell Autoantigen 1 (ICA1)

Sign In for Pricing
View Details