Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RABEPK Rabbit Polyclonal Antibody (HRP)

RABEPK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P40, RAB9P40, bA65N13.1

UniProt

Q7Z6M1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RABEPK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005824

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLN6 polyclonal antibody
BS77753-01 50 µL

CLN6 polyclonal antibody

Sign In for Pricing
View Details
CLN6 polyclonal antibody
BS77753-02 100 µL

CLN6 polyclonal antibody

Sign In for Pricing
View Details
GK5 Human Gene Knockout Kit (CRISPR)
KN424409 1 Kit

GK5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-WNT8B Antibody Picoband® Fluoro647 Conjugated
A07933-1-Fluoro647 100 µg/Vial

Anti-WNT8B Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Laminin alpha 4 (LAMA4) Mouse Monoclonal Antibody [Clone ID: 6C3]
AM26108PU-N 100 µg

Laminin alpha 4 (LAMA4) Mouse Monoclonal Antibody [Clone ID: 6C3]

Sign In for Pricing
View Details
SPRN, CT (SPRN, SHO, Shadow of prion protein) (Biotin) discontinued
042264-Biotin 200 µL

SPRN, CT (SPRN, SHO, Shadow of prion protein) (Biotin) discontinued

Sign In for Pricing
View Details