Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RABEPK Rabbit Polyclonal Antibody (HRP)

RABEPK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P40, RAB9P40, bA65N13.1

UniProt

Q7Z6M1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RABEPK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005824

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Dual Oxidase 2 ELISA Kit
MBS060058-01 48 Well

Mouse Dual Oxidase 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Dual Oxidase 2 ELISA Kit
MBS060058-02 96 Well

Mouse Dual Oxidase 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Dual Oxidase 2 ELISA Kit
MBS060058-03 5x 96 Well

Mouse Dual Oxidase 2 ELISA Kit

Sign In for Pricing
View Details
Mouse Dual Oxidase 2 ELISA Kit
MBS060058-04 10x 96 Well

Mouse Dual Oxidase 2 ELISA Kit

Sign In for Pricing
View Details
RTM2 Antibody
orb796161 2 mg

RTM2 Antibody

Sign In for Pricing
View Details
SEL24-B489 100mg
A22203-100 100 mg

SEL24-B489 100mg

Sign In for Pricing
View Details