Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIDA Rabbit Polyclonal Antibody (Biotin)

RIDA Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PSP, P14.5, UK114, HRSP12, hp14.5

UniProt

P52758

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HRSP12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_005827

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF148, NT (ZNF148, ZBP89, Zinc finger protein 148, Transcription factor ZBP-89, Zinc finger DNA-binding protein 89) (FITC)
MBS6365692-01 0.2 mL

ZNF148, NT (ZNF148, ZBP89, Zinc finger protein 148, Transcription factor ZBP-89, Zinc finger DNA-binding protein 89) (FITC)

Sign In for Pricing
View Details
ZNF148, NT (ZNF148, ZBP89, Zinc finger protein 148, Transcription factor ZBP-89, Zinc finger DNA-binding protein 89) (FITC)
MBS6365692-02 5x 0.2 mL

ZNF148, NT (ZNF148, ZBP89, Zinc finger protein 148, Transcription factor ZBP-89, Zinc finger DNA-binding protein 89) (FITC)

Sign In for Pricing
View Details
TSC1, phosphorylated (S312) (Tsc1, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 550) discontinued
043314-ML550 100 µL

TSC1, phosphorylated (S312) (Tsc1, Hamartin, Tuberous sclerosis 1 protein homolog) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Smpd2 3'UTR GFP Stable Cell Line
TU169343 1.0 mL

Smpd2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Tartrate Resistant Acid Phosphatase (ACP5) Human Over-expression Lysate
orb1358550 100 µg

Tartrate Resistant Acid Phosphatase (ACP5) Human Over-expression Lysate

Sign In for Pricing
View Details
ACY-957
C04618-1mg 1 mg

ACY-957

Sign In for Pricing
View Details