Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIDA Rabbit Polyclonal Antibody (FITC)

RIDA Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PSP, P14.5, UK114, HRSP12, hp14.5

UniProt

P52758

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HRSP12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_005827

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC5A7 Protein Vector (Human) (pPM-C-His)
PV058032 500 ng

SLC5A7 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit anti-Rotavirus A Intermediate capsid protein VP6 polyclonal Antibody; Intermediate capsid protein VP6
MBS1491141-01 0.05 mg

Rabbit anti-Rotavirus A Intermediate capsid protein VP6 polyclonal Antibody; Intermediate capsid protein VP6

Sign In for Pricing
View Details
Rabbit anti-Rotavirus A Intermediate capsid protein VP6 polyclonal Antibody; Intermediate capsid protein VP6
MBS1491141-02 0.1 mg

Rabbit anti-Rotavirus A Intermediate capsid protein VP6 polyclonal Antibody; Intermediate capsid protein VP6

Sign In for Pricing
View Details
Rabbit anti-Rotavirus A Intermediate capsid protein VP6 polyclonal Antibody; Intermediate capsid protein VP6
MBS1491141-03 5x 0.1 mg

Rabbit anti-Rotavirus A Intermediate capsid protein VP6 polyclonal Antibody; Intermediate capsid protein VP6

Sign In for Pricing
View Details
Calpain 10 Polyclonal Antibody
orb1414482 100 µL

Calpain 10 Polyclonal Antibody

Sign In for Pricing
View Details
TMEM9B Recombinant Protein (Mouse)
RP179987 100 µg

TMEM9B Recombinant Protein (Mouse)

Sign In for Pricing
View Details