Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NET1 Rabbit Polyclonal Antibody (FITC)

NET1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NET1A, ARHGEF8

UniProt

Q5SQI7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NET1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005854

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnf168 Antibody
orb861057 2 mg

Rnf168 Antibody

Sign In for Pricing
View Details
NOS1AP, ID (NOS1AP, CAPON, KIAA0464, Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein, C-terminal PDZ ligand of neuronal nitric oxide synthase protein, Nitric oxide synthase 1 adaptor protein) (MaxLight 650)
MBS6326013-01 0.1 mL

NOS1AP, ID (NOS1AP, CAPON, KIAA0464, Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein, C-terminal PDZ ligand of neuronal nitric oxide synthase protein, Nitric oxide synthase 1 adaptor protein) (MaxLight 650)

Sign In for Pricing
View Details
NOS1AP, ID (NOS1AP, CAPON, KIAA0464, Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein, C-terminal PDZ ligand of neuronal nitric oxide synthase protein, Nitric oxide synthase 1 adaptor protein) (MaxLight 650)
MBS6326013-02 5x 0.1 mL

NOS1AP, ID (NOS1AP, CAPON, KIAA0464, Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein, C-terminal PDZ ligand of neuronal nitric oxide synthase protein, Nitric oxide synthase 1 adaptor protein) (MaxLight 650)

Sign In for Pricing
View Details
Dynamin-1 (Phospho-Ser774) Antibody
orb127982-01 25 µg

Dynamin-1 (Phospho-Ser774) Antibody

Sign In for Pricing
View Details
Dynamin-1 (Phospho-Ser774) Antibody
orb127982-02 50 µg

Dynamin-1 (Phospho-Ser774) Antibody

Sign In for Pricing
View Details
Dynamin-1 (Phospho-Ser774) Antibody
orb127982-03 100 µg

Dynamin-1 (Phospho-Ser774) Antibody

Sign In for Pricing
View Details