Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBB4 Rabbit Polyclonal Antibody (HRP)

TUBB4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DYT4, TUBB4, beta-5

UniProt

P04350

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TUBB4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006078

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human AXL/UFO Protein (Fc Tag)
PDMH100293-01 20 µg

Recombinant Human AXL/UFO Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human AXL/UFO Protein (Fc Tag)
PDMH100293-02 100 µg

Recombinant Human AXL/UFO Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human AXL/UFO Protein (Fc Tag)
PDMH100293-03 500 µg

Recombinant Human AXL/UFO Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human AXL/UFO Protein (Fc Tag)
PDMH100293-04 1 mg

Recombinant Human AXL/UFO Protein (Fc Tag)

Sign In for Pricing
View Details
3-Phenoxybenzoic Acid
TRC-P228010-5G 5 g

3-Phenoxybenzoic Acid

Sign In for Pricing
View Details
Gemin 8 (GEMIN8) Mouse Monoclonal Antibody [Clone ID: OTI4B12]
CF805834 100 µg

Gemin 8 (GEMIN8) Mouse Monoclonal Antibody [Clone ID: OTI4B12]

Sign In for Pricing
View Details