Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coro2b Rabbit Polyclonal Antibody (HRP)

Coro2b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CLIPINC, E130012P22Rik

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Coro2b

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GGSFLVIPLEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTS

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_780693

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CIB4 Human shRNA Plasmid Kit (Locus ID 130106)
TR315348 1 Kit

CIB4 Human shRNA Plasmid Kit (Locus ID 130106)

Sign In for Pricing
View Details
NADP (Standard)
HY-113325R-01 5 mg

NADP (Standard)

Sign In for Pricing
View Details
NADP (Standard)
HY-113325R-02 10 mg

NADP (Standard)

Sign In for Pricing
View Details
NADP (Standard)
HY-113325R-03 25 mg

NADP (Standard)

Sign In for Pricing
View Details
NADP (Standard)
HY-113325R-04 50 mg

NADP (Standard)

Sign In for Pricing
View Details
NADP (Standard)
HY-113325R-05 100 mg

NADP (Standard)

Sign In for Pricing
View Details