Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAPGEF3 Rabbit Polyclonal Antibody (FITC)

RAPGEF3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EPAC, EPAC1, bcm910, HSU79275, CAMP-GEFI

UniProt

A8K2G5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RAPGEF3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006096

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIC 305-TRI 200-B7541 (BRANDED) Safety & Regulatory Compliance Signs & Labels (Adhesive)
250217 1 Card (1 Panel (s) x 1 Pack)

PIC 305-TRI 200-B7541 (BRANDED) Safety & Regulatory Compliance Signs & Labels (Adhesive)

Sign In for Pricing
View Details
ESD (D-4) : m-IgG Fc BP-HRP Bundle
sc-538677 1 Kit

ESD (D-4) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Phospho-v-Myb + c-Myb (S11) (2Q12) Rabbit Monoclonal Antibody
orb3013553 100 µL

Phospho-v-Myb + c-Myb (S11) (2Q12) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal ODF2L Antibody
NBP1-82921 0.1 mL

Rabbit Polyclonal ODF2L Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal RPUSD4 Antibody
NBP2-93188-0.02mL 0.02 mL

Rabbit Polyclonal RPUSD4 Antibody

Sign In for Pricing
View Details
Mouse Anti Human Herpesvirus 8
MBS140263-01 0.005 mg

Mouse Anti Human Herpesvirus 8

Sign In for Pricing
View Details