Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAPGEF3 Rabbit Polyclonal Antibody (HRP)

RAPGEF3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EPAC, EPAC1, bcm910, HSU79275, CAMP-GEFI

UniProt

A8K2G5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RAPGEF3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006096

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti- RET Antibody
GWB-C939E3 0.1 mg

Anti- RET Antibody

Sign In for Pricing
View Details
Polyclonal Nfia Antibody - middle region
AMM06671G 0.05mg

Polyclonal Nfia Antibody - middle region

Sign In for Pricing
View Details
FXYD Domain-containing Ion Transport Regulator 1, phosphorylated (Ser68) (Phospholemman, FLM, Fxyd1, Plm) (MaxLight 650) discontinued
F9400-04-ML650 100 µL

FXYD Domain-containing Ion Transport Regulator 1, phosphorylated (Ser68) (Phospholemman, FLM, Fxyd1, Plm) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Ethyl 2-bromophenylacetate
OR26136-01 5 g

Ethyl 2-bromophenylacetate

Sign In for Pricing
View Details
Ethyl 2-bromophenylacetate
OR26136-02 500 g

Ethyl 2-bromophenylacetate

Sign In for Pricing
View Details
Dual Specificity Protein Kinase TTK (TTK, MPS1, MPS1L1, Phosphotyrosine Picked Threonine-protein Kinase, PYT) (Not for Export EU)
134865 100 µL

Dual Specificity Protein Kinase TTK (TTK, MPS1, MPS1L1, Phosphotyrosine Picked Threonine-protein Kinase, PYT) (Not for Export EU)

Sign In for Pricing
View Details