Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIBF1 Rabbit Polyclonal Antibody (FITC)

PIBF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PIBF, CEP90, JBTS33, C13orf24

UniProt

Q8WXW3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PIBF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RKDQVTQLSQELDRANSLLNQTQQPYRYLIESVRQRDSKIDSLTESIAQL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adhfe1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6292907 1.0 µg DNA

Adhfe1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
PUF60 Polyclonal Antibody, Cy5.5 Conjugated
bs-19595R-Cy5.5 100 µL

PUF60 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. novicida Protoheme IX farnesyltransferase (cyoE), partial
MBS1116582-01 1 mg (E-Coli)

Recombinant Francisella tularensis subsp. novicida Protoheme IX farnesyltransferase (cyoE), partial

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. novicida Protoheme IX farnesyltransferase (cyoE), partial
MBS1116582-02 1 mg (Yeast)

Recombinant Francisella tularensis subsp. novicida Protoheme IX farnesyltransferase (cyoE), partial

Sign In for Pricing
View Details
Chicken Cyclophilin D ELISA Kit
MBS024479 Inquire

Chicken Cyclophilin D ELISA Kit

Sign In for Pricing
View Details
DDX23 Recombinant Protein (Human)
RP008974 100 µg

DDX23 Recombinant Protein (Human)

Sign In for Pricing
View Details