Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIBF1 Rabbit Polyclonal Antibody (HRP)

PIBF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PIBF, CEP90, JBTS33, C13orf24

UniProt

Q8WXW3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PIBF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RKDQVTQLSQELDRANSLLNQTQQPYRYLIESVRQRDSKIDSLTESIAQL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006337

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IRGQ activation kit by CRISPRa
GA114931 1 Kit

Human IRGQ activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant SATB1 Antibody
RC-15351-01 50 μL

Recombinant SATB1 Antibody

Sign In for Pricing
View Details
Recombinant SATB1 Antibody
RC-15351-02 100 µL

Recombinant SATB1 Antibody

Sign In for Pricing
View Details
Recombinant SATB1 Antibody
RC-15351-03 1 mL

Recombinant SATB1 Antibody

Sign In for Pricing
View Details
GLI3 Rabbit Polyclonal Antibody
TA368062 100 µL

GLI3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB508603 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details