Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPIH Rabbit Polyclonal Antibody (Biotin)

PPIH Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CYPH, CYP-20, USA-CYP, SnuCyp-20

UniProt

O43447

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPIH

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006338

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Dengue Virus NS5 Antibody (02) [Janelia Fluor 669]
NBP3-30750JF669 0.1 mL

Mouse Monoclonal Dengue Virus NS5 Antibody (02) [Janelia Fluor 669]

Sign In for Pricing
View Details
CCAAT/enhancer binding protein zeta Immunizing Peptide
MBS427877-01 0.1 mg

CCAAT/enhancer binding protein zeta Immunizing Peptide

Sign In for Pricing
View Details
CCAAT/enhancer binding protein zeta Immunizing Peptide
MBS427877-02 5x 0.1 mg

CCAAT/enhancer binding protein zeta Immunizing Peptide

Sign In for Pricing
View Details
SLC25A32 (NM_030780) Human Tagged ORF Clone
RC204580 10 µg

SLC25A32 (NM_030780) Human Tagged ORF Clone

Sign In for Pricing
View Details
SMPX CRISPR Activation Plasmid (h2)
sc-416472-ACT-2 20 µg

SMPX CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Gkn2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3683605 3x 1.0 µg

Gkn2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details