Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMM44 Rabbit Polyclonal Antibody (HRP)

TIMM44 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TIM44

UniProt

O43615

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TIMM44

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_006342

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FIP1L1 Rabbit Polyclonal Antibody (Fluoro647)
orb3110594 100 µg

FIP1L1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
ZNF861P CRISPR All-in-one AAV vector set (with saCas9)(Human)
51894151 3x 1.0 µg DNA

ZNF861P CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
GUCY1B3 (Guanylate Cyclase 1 Beta 3, GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B1, GC-S-beta-1) (APC)
MBS6419721-01 0.1 mL

GUCY1B3 (Guanylate Cyclase 1 Beta 3, GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B1, GC-S-beta-1) (APC)

Sign In for Pricing
View Details
GUCY1B3 (Guanylate Cyclase 1 Beta 3, GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B1, GC-S-beta-1) (APC)
MBS6419721-02 5x 0.1 mL

GUCY1B3 (Guanylate Cyclase 1 Beta 3, GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B1, GC-S-beta-1) (APC)

Sign In for Pricing
View Details
EV450 Anti-Mouse Ly6C Antibody [Monts 1]
MBS2568355-01 50 Tests

EV450 Anti-Mouse Ly6C Antibody [Monts 1]

Sign In for Pricing
View Details
EV450 Anti-Mouse Ly6C Antibody [Monts 1]
MBS2568355-02 100 Tests

EV450 Anti-Mouse Ly6C Antibody [Monts 1]

Sign In for Pricing
View Details