Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APPBP2 Rabbit Polyclonal Antibody (FITC)

APPBP2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PAT1, APP-BP2, HS.84084

UniProt

Q92624

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human APPBP2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLLDYGFYLLN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006371

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CLEC2D/OCIL/LLT1 Protein, C-Fc
EHK17201 100 μg

Recombinant Human CLEC2D/OCIL/LLT1 Protein, C-Fc

Sign In for Pricing
View Details
Pack of 100 Filter Discs For Clarification, 328 Mm Capillery (4 Packs of 25)
FT307A0328_CAPC Pack of 100

Pack of 100 Filter Discs For Clarification, 328 Mm Capillery (4 Packs of 25)

Sign In for Pricing
View Details
Anti-POLR3D Antibody Picoband®
A11611-2 100 µg/Vial

Anti-POLR3D Antibody Picoband®

Sign In for Pricing
View Details
Monkey Anti Cluster of Differentiation 46 ELISA Kit
MBS7211928-01 48 Well

Monkey Anti Cluster of Differentiation 46 ELISA Kit

Sign In for Pricing
View Details
Monkey Anti Cluster of Differentiation 46 ELISA Kit
MBS7211928-02 96 Well

Monkey Anti Cluster of Differentiation 46 ELISA Kit

Sign In for Pricing
View Details
Monkey Anti Cluster of Differentiation 46 ELISA Kit
MBS7211928-03 5x 96 Well

Monkey Anti Cluster of Differentiation 46 ELISA Kit

Sign In for Pricing
View Details