Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APPBP2 Rabbit Polyclonal Antibody (HRP)

APPBP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PAT1, APP-BP2, HS.84084

UniProt

Q92624

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human APPBP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLLDYGFYLLN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006371

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin L HC Blocking Peptide
MBS8309008-01 1 mg

Cathepsin L HC Blocking Peptide

Sign In for Pricing
View Details
Cathepsin L HC Blocking Peptide
MBS8309008-02 5 mg

Cathepsin L HC Blocking Peptide

Sign In for Pricing
View Details
Cathepsin L HC Blocking Peptide
MBS8309008-03 5x 5 mg

Cathepsin L HC Blocking Peptide

Sign In for Pricing
View Details
SAMS Peptide (Substrate for AMP-activated Protein Kinase)
S0090 250 µg

SAMS Peptide (Substrate for AMP-activated Protein Kinase)

Sign In for Pricing
View Details
Recombinant Desulfovibrio magneticus Pantothenate synthetase (panC)
MBS1014501-01 0.02 mg (E-Coli)

Recombinant Desulfovibrio magneticus Pantothenate synthetase (panC)

Sign In for Pricing
View Details
Recombinant Desulfovibrio magneticus Pantothenate synthetase (panC)
MBS1014501-02 0.02 mg (Yeast)

Recombinant Desulfovibrio magneticus Pantothenate synthetase (panC)

Sign In for Pricing
View Details