Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slu7 Rabbit Polyclonal Antibody (HRP)

Slu7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AU018913, D11Ertd730, D3Bwg0878e, D11Ertd730e

UniProt

Q8BHJ9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EELASGKLVEQANSPKHQWGEEEPNSQMEKDHNSEDEDEDKYADDIDMPG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_683514

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G6PC 3'UTR GFP Stable Cell Line
TU058436 1.0 mL

G6PC 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
N- (2,3-Dimethylphenyl) mefenamic acid carboxamide
WAA12268 1000 mg

N- (2,3-Dimethylphenyl) mefenamic acid carboxamide

Sign In for Pricing
View Details
Cattle S100A8 (S100 Calcium Binding Protein A8) ELISA Kit
MBS8822180-01 48 Well

Cattle S100A8 (S100 Calcium Binding Protein A8) ELISA Kit

Sign In for Pricing
View Details
Cattle S100A8 (S100 Calcium Binding Protein A8) ELISA Kit
MBS8822180-02 96 Well

Cattle S100A8 (S100 Calcium Binding Protein A8) ELISA Kit

Sign In for Pricing
View Details
Cattle S100A8 (S100 Calcium Binding Protein A8) ELISA Kit
MBS8822180-03 5x 96 Well

Cattle S100A8 (S100 Calcium Binding Protein A8) ELISA Kit

Sign In for Pricing
View Details
Cattle S100A8 (S100 Calcium Binding Protein A8) ELISA Kit
MBS8822180-04 10x 96 Well

Cattle S100A8 (S100 Calcium Binding Protein A8) ELISA Kit

Sign In for Pricing
View Details