Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTHFS Rabbit Polyclonal Antibody (HRP)

MTHFS Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NEDMEHM, HsT19268

UniProt

P49914

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MTHFS

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_006432

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DFNB88 Protein Lysate (Human) with C-Ha Tag
18129031 100 µg

DFNB88 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)
MBS2050424-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)
MBS2050424-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)
MBS2050424-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)
MBS2050424-04 1 mL

APC/CY7-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)
MBS2050424-05 5 mL

APC/CY7-Linked Polyclonal Antibody to Low Density Lipoprotein Receptor Related Protein 1 (LRP1)

Sign In for Pricing
View Details