Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3C Rabbit Polyclonal Antibody (FITC)

POLR3C Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C82, RPC3, RPC62

UniProt

Q9BUI4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POLR3C

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VEAIIASMQATGAEEAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_006459

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf194 Human Gene Knockout Kit (CRISPR)
KN425142 1 Kit

C1orf194 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cardiac Troponin T (TNNT2) Mouse Monoclonal Antibody [Clone ID: OTI5D9]
CF807904 100 µg

Cardiac Troponin T (TNNT2) Mouse Monoclonal Antibody [Clone ID: OTI5D9]

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur, head
CS707043 5x 5 µm

Tissue FFPE Sections, Bone: femur, head

Sign In for Pricing
View Details
HPRT Mouse Monoclonal Antibody [Clone ID: 1F8D11]
AM06114SU-N 100 µL

HPRT Mouse Monoclonal Antibody [Clone ID: 1F8D11]

Sign In for Pricing
View Details
LCN15 (NM_203347) Human Over-expression Lysate
LC404406 20 µg

LCN15 (NM_203347) Human Over-expression Lysate

Sign In for Pricing
View Details
Meis homeobox 3 (MEIS3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D9]
TA800265BM 100 µL

Meis homeobox 3 (MEIS3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D9]

Sign In for Pricing
View Details