Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3C Rabbit Polyclonal Antibody (HRP)

POLR3C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C82, RPC3, RPC62

UniProt

Q9BUI4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human POLR3C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VEAIIASMQATGAEEAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_006459

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GTP cyclohydrolase 1,GCH1 ELISA KIT
JOT-EK5366Hu-01 96 Well

Human GTP cyclohydrolase 1,GCH1 ELISA KIT

Sign In for Pricing
View Details
Human GTP cyclohydrolase 1,GCH1 ELISA KIT
JOT-EK5366Hu-02 48 Well

Human GTP cyclohydrolase 1,GCH1 ELISA KIT

Sign In for Pricing
View Details
3-Oxo-butanoic Acid 2-[ (3,3-Diphenylpropyl) methylamino]-1,1-dimethylethyl Ester
426571-01 10 mg

3-Oxo-butanoic Acid 2-[ (3,3-Diphenylpropyl) methylamino]-1,1-dimethylethyl Ester

Sign In for Pricing
View Details
3-Oxo-butanoic Acid 2-[ (3,3-Diphenylpropyl) methylamino]-1,1-dimethylethyl Ester
426571-02 25 mg

3-Oxo-butanoic Acid 2-[ (3,3-Diphenylpropyl) methylamino]-1,1-dimethylethyl Ester

Sign In for Pricing
View Details
2- (4-Isopropyl-6-oxo-1,6-dihydro-pyrimidin-2-ylsulfanyl) -propionic acid
sc-320863 500 mg

2- (4-Isopropyl-6-oxo-1,6-dihydro-pyrimidin-2-ylsulfanyl) -propionic acid

Sign In for Pricing
View Details
Anti-SIX1 Antibody Picoband® Fluoro488 Conjugated
PB9889-Fluoro488 100 µg/Vial

Anti-SIX1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details