Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rasl10a Rabbit Polyclonal Antibody (HRP)

Rasl10a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI852688, 2210403B10Rik

UniProt

Q8K5A4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TAIIRQFLFGDYPERHRPTDSPCLYRPAVLLDGAVYDLSIRDGDVAGPGS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_660251

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA Epitope Tag (YPYDVPDYA) Mouse Monoclonal Antibody [Clone ID: 5D8]
AM26678AF-N 100 µL

HA Epitope Tag (YPYDVPDYA) Mouse Monoclonal Antibody [Clone ID: 5D8]

Sign In for Pricing
View Details
SOX17 Human Gene Knockout Kit (CRISPR)
KN220888LP 1 Kit

SOX17 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cofilin 2 (CFL2) (NM_138638) Human Recombinant Protein
TP322215 20 µg

Cofilin 2 (CFL2) (NM_138638) Human Recombinant Protein

Sign In for Pricing
View Details
CD45 (PTPRC) (CD45RA) Mouse Monoclonal Antibody [Clone ID: B-C15]
AM31226PU-N 2 mL (200 Tests)

CD45 (PTPRC) (CD45RA) Mouse Monoclonal Antibody [Clone ID: B-C15]

Sign In for Pricing
View Details
Nuclear Membrane (AE-5), CF647 conjugate, 0.1mg/mL
BNC470867-500 1x 500 µL

Nuclear Membrane (AE-5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Peritoneum
CS702623 5x 5 µm

Tissue FFPE Sections, Peritoneum

Sign In for Pricing
View Details