Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WASF3 Rabbit Polyclonal Antibody (HRP)

WASF3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SCAR3, WAVE3, Brush-1

UniProt

Q9UPY6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human WASF3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006637

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Krt20 qPCR Primer Pair
QM32730S 200 Tests

Mouse Krt20 qPCR Primer Pair

Sign In for Pricing
View Details
Lentiviral human RNASE8 shRNA (UAS) - Lentiviral human RNASE8 shRNA (UAS, RFP) (100)
GTR15153456 1 Vial

Lentiviral human RNASE8 shRNA (UAS) - Lentiviral human RNASE8 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
DiscoveryProbe™ Tyrosine Kinase Inhibitor Library
L1028-.1 100 µL/Well (10 mM Solution) - 96 Well Racks With Screw Cap

DiscoveryProbe™ Tyrosine Kinase Inhibitor Library

Sign In for Pricing
View Details
Bz-Ile-Glu-Gly-Arg-pNA HCl (S222, FXa substrate)
orb525753-01 100 mg

Bz-Ile-Glu-Gly-Arg-pNA HCl (S222, FXa substrate)

Sign In for Pricing
View Details
Bz-Ile-Glu-Gly-Arg-pNA HCl (S222, FXa substrate)
orb525753-02 250 mg

Bz-Ile-Glu-Gly-Arg-pNA HCl (S222, FXa substrate)

Sign In for Pricing
View Details
Bz-Ile-Glu-Gly-Arg-pNA HCl (S222, FXa substrate)
orb525753-03 1 g

Bz-Ile-Glu-Gly-Arg-pNA HCl (S222, FXa substrate)

Sign In for Pricing
View Details