Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Smpdl3a Rabbit Polyclonal Antibody (HRP)

Smpdl3a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AS, ASM3A, ASML3, ASML3A, AI529588, 0610010C24Rik

UniProt

P70158

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065586

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUCY1A3 (NM_001130686) Human Tagged ORF Clone Lentiviral Particle
RC225555L4V 200 µL

GUCY1A3 (NM_001130686) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MRP-S2 Double Nickase Plasmid (m)
sc-431198-NIC 20 µg

MRP-S2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Dsk2 Antibody (C-term)
orb33799 400 µL

Dsk2 Antibody (C-term)

Sign In for Pricing
View Details
uPA (PLAU) (C-term) Rabbit Polyclonal Antibody
AP15165PU-N 400 µL

uPA (PLAU) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IGF1R protein (His tag)
PDMH100060-01 20 µg

Recombinant Human IGF1R protein (His tag)

Sign In for Pricing
View Details
Recombinant Human IGF1R protein (His tag)
PDMH100060-02 100 µg

Recombinant Human IGF1R protein (His tag)

Sign In for Pricing
View Details