Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP3M2 Rabbit Polyclonal Antibody (Biotin)

AP3M2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P47B, AP47B, CLA20

UniProt

P53677

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human AP3M2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006794

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hyperforin acetate
orb1480276 5 mg

Hyperforin acetate

Sign In for Pricing
View Details
PICALM (Phosphatidylinositol-Binding Clathrin Assembly Protein, Clathrin Assembly lymphoid Myeloid Leukemia Protein, PICALM, CALM) (FITC)
MBS6458134-01 0.1 mL

PICALM (Phosphatidylinositol-Binding Clathrin Assembly Protein, Clathrin Assembly lymphoid Myeloid Leukemia Protein, PICALM, CALM) (FITC)

Sign In for Pricing
View Details
PICALM (Phosphatidylinositol-Binding Clathrin Assembly Protein, Clathrin Assembly lymphoid Myeloid Leukemia Protein, PICALM, CALM) (FITC)
MBS6458134-02 5x 0.1 mL

PICALM (Phosphatidylinositol-Binding Clathrin Assembly Protein, Clathrin Assembly lymphoid Myeloid Leukemia Protein, PICALM, CALM) (FITC)

Sign In for Pricing
View Details
Mouse HLA-DR/DP/DQ Monoclonal Antibody
orb1520084 100 ug (BSA-free)

Mouse HLA-DR/DP/DQ Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Clostridium tetani Uridylate kinase (pyrH)
MBS1406807-01 0.02 mg (E-Coli)

Recombinant Clostridium tetani Uridylate kinase (pyrH)

Sign In for Pricing
View Details
Recombinant Clostridium tetani Uridylate kinase (pyrH)
MBS1406807-02 0.1 mg (E-Coli)

Recombinant Clostridium tetani Uridylate kinase (pyrH)

Sign In for Pricing
View Details