Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNRC1 Rabbit Polyclonal Antibody (FITC)

PNRC1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

B4-2, PRR2, PROL2, PNAS-145

UniProt

Q12796

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PNRC1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KEVLKSKMGKSEKIALPHGQLVHGIHLYEQPKINRQKSKYNLPLTKITSA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006804

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Advanced oxidation protein products (AOPP) ELISA Kit
MBS268002-01 48 Well

Porcine Advanced oxidation protein products (AOPP) ELISA Kit

Sign In for Pricing
View Details
Porcine Advanced oxidation protein products (AOPP) ELISA Kit
MBS268002-02 96 Well

Porcine Advanced oxidation protein products (AOPP) ELISA Kit

Sign In for Pricing
View Details
Porcine Advanced oxidation protein products (AOPP) ELISA Kit
MBS268002-03 5x 96 Well

Porcine Advanced oxidation protein products (AOPP) ELISA Kit

Sign In for Pricing
View Details
Porcine Advanced oxidation protein products (AOPP) ELISA Kit
MBS268002-04 10x 96 Well

Porcine Advanced oxidation protein products (AOPP) ELISA Kit

Sign In for Pricing
View Details
ERCC2 Antibody
A20817-100UL 100 µL

ERCC2 Antibody

Sign In for Pricing
View Details
Tjp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
46743114 3x 1.0 µg

Tjp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details