Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB35 Rabbit Polyclonal Antibody (HRP)

RAB35 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RAY, H-ray, RAB1C

UniProt

Q15286

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAB35

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006852

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MYOC shRNA (UAS) - Lentiviral human MYOC shRNA (UAS, iRFP) (100)
GTR15326946 1 Vial

Lentiviral human MYOC shRNA (UAS) - Lentiviral human MYOC shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
SSTR4 Rabbit pAb
E47R21861 100 µL

SSTR4 Rabbit pAb

Sign In for Pricing
View Details
ZNF677 Peptide (AAP36274)
AAP36274-100UG 100 µg

ZNF677 Peptide (AAP36274)

Sign In for Pricing
View Details
TRPV5 Protein Vector (Human) (pPM-C-His)
PV044116 500 ng

TRPV5 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Stem Cell Factor CLIA Kit
MBS8426477-01 1 Kit

Mouse Stem Cell Factor CLIA Kit

Sign In for Pricing
View Details
Mouse Stem Cell Factor CLIA Kit
MBS8426477-02 5x 1 Kit

Mouse Stem Cell Factor CLIA Kit

Sign In for Pricing
View Details