Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIM2 Rabbit Polyclonal Antibody (Biotin)

PIM2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9P1W9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PIM2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006866

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUT10 Rabbit Polyclonal Antibody (Biotin)
orb455739 100 µL

FUT10 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Lentiviral mouse Nfxl1 shRNA (UAS) - Lentiviral mouse Nfxl1 shRNA (UAS, iRFP) (25)
GTR15172262 1 Vial

Lentiviral mouse Nfxl1 shRNA (UAS) - Lentiviral mouse Nfxl1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Human POLI Pre-designed siRNA Set A
SI012507A 1 Each

Human POLI Pre-designed siRNA Set A

Sign In for Pricing
View Details
Cole-Parmer TR-200D Tube Rotator Variable Speed
MIX1960 1 Each

Cole-Parmer TR-200D Tube Rotator Variable Speed

Sign In for Pricing
View Details
Rabbit Keratin growth factor receptor ELISA Kit
MBS724913-01 48 Well

Rabbit Keratin growth factor receptor ELISA Kit

Sign In for Pricing
View Details
Rabbit Keratin growth factor receptor ELISA Kit
MBS724913-02 96 Well

Rabbit Keratin growth factor receptor ELISA Kit

Sign In for Pricing
View Details