Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Katna1 Rabbit Polyclonal Antibody (FITC)

Katna1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q9WV86

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSAKGREELLRISLR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035965

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LILRB1 (Leukocyte Immunoglobulin-like Receptor Subfamily B Member 1, LIR-1, Leukocyte Immunoglobulin-like Receptor 1, CD85 Antigen-like Family Member J, Immunoglobulin-like Transcript 2, ILT-2, Monocyte/Macrophage Immunoglobulin-like Receptor 7, MIR-7, CD85j, ILT2, LIR1, MIR7, FLJ37515) (Biotin)
129094-Biotin 100 µL

LILRB1 (Leukocyte Immunoglobulin-like Receptor Subfamily B Member 1, LIR-1, Leukocyte Immunoglobulin-like Receptor 1, CD85 Antigen-like Family Member J, Immunoglobulin-like Transcript 2, ILT-2, Monocyte/Macrophage Immunoglobulin-like Receptor 7, MIR-7, CD85j, ILT2, LIR1, MIR7, FLJ37515) (Biotin)

Sign In for Pricing
View Details
4,5-Diamino catechol
FD02167-01 1 g

4,5-Diamino catechol

Sign In for Pricing
View Details
4,5-Diamino catechol
FD02167-02 2 g

4,5-Diamino catechol

Sign In for Pricing
View Details
4,5-Diamino catechol
FD02167-03 5 g

4,5-Diamino catechol

Sign In for Pricing
View Details
4,5-Diamino catechol
FD02167-04 10 g

4,5-Diamino catechol

Sign In for Pricing
View Details
IKKε Antibody [M18J19]
C18985-50uL 50 μL

IKKε Antibody [M18J19]

Sign In for Pricing
View Details