Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ap4s1 Rabbit Polyclonal Antibody (HRP)

Ap4s1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

F1M5X2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Ap4s1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VSKSCLSRSSEQCSFIEYKDFKLIYRQYAALFVVVGVNDTENEMAIYEFI

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001124471

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CAPN13 Pre-designed siRNA Set B
SI002160B 1 Each

Human CAPN13 Pre-designed siRNA Set B

Sign In for Pricing
View Details
RGS16, NT (RGS16, RGSR, Regulator of G-protein signaling 16, A28-RGS14P, Retinal-specific RGS, Retinally abundant regulator of G-protein signaling) (MaxLight 750) discontinued
041006-ML750 100 µL

RGS16, NT (RGS16, RGSR, Regulator of G-protein signaling 16, A28-RGS14P, Retinal-specific RGS, Retinally abundant regulator of G-protein signaling) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Camel FYN-Binding Protein (FYB) ELISA Kit
MBS9936068 Inquire

Camel FYN-Binding Protein (FYB) ELISA Kit

Sign In for Pricing
View Details
Histone H1 (1415-1), CF647 conjugate, 0.1mg/mL
BNC470580-100 1x 100 µL

Histone H1 (1415-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DDB1 Antibody - middle region (ARP87409_P050)
ARP87409_P050 100 µL

DDB1 Antibody - middle region (ARP87409_P050)

Sign In for Pricing
View Details
Il1rap ORF Vector (Mouse) (pORF)
ORF047849 1.0 µg DNA

Il1rap ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details