Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP50 Rabbit Polyclonal Antibody (HRP)

NUP50 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rtp60, Npap60

UniProt

O08587

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Npap60

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VEEMGTFSVASEEVMKNRAVKKAKRRNIGFESDSGGAFKGFKGLVVPSGG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_037123

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT10 (Cytokeratin 10, Keratin, Type I Cytoskeletal 10, Cytokeratin-10, CK-10, Keratin-10, K10, KPP) discontinued
138074 100 µg

KRT10 (Cytokeratin 10, Keratin, Type I Cytoskeletal 10, Cytokeratin-10, CK-10, Keratin-10, K10, KPP) discontinued

Sign In for Pricing
View Details
Ubidecarenone (Coenzyme Q10) Impurity 40
RM-U020440-01 10 mg

Ubidecarenone (Coenzyme Q10) Impurity 40

Sign In for Pricing
View Details
Ubidecarenone (Coenzyme Q10) Impurity 40
RM-U020440-02 100 mg

Ubidecarenone (Coenzyme Q10) Impurity 40

Sign In for Pricing
View Details
Ubidecarenone (Coenzyme Q10) Impurity 40
RM-U020440-03 25 mg

Ubidecarenone (Coenzyme Q10) Impurity 40

Sign In for Pricing
View Details
Ubidecarenone (Coenzyme Q10) Impurity 40
RM-U020440-04 50 mg

Ubidecarenone (Coenzyme Q10) Impurity 40

Sign In for Pricing
View Details
PI 3-kinase p100 Double Nickase Plasmid (m)
sc-432531-NIC 20 µg

PI 3-kinase p100 Double Nickase Plasmid (m)

Sign In for Pricing
View Details