Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC23IP Rabbit Polyclonal Antibody (HRP)

SEC23IP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P125, P125A, MSTP053, iPLA1beta

UniProt

Q9Y6Y8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SEC23IP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SIHTSAPQTFSYFSQVSSSSDPFGNIGQSPLTTAATSVGQSGFPKPLTAL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

111kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_009121

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrap sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4438908 1.0 µg DNA

Mrap sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Chmp2b Rabbit Polyclonal Antibody
orb582572 100 µL

Chmp2b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Streptococcus equi subsp. zooepidemicus Protein translocase subunit SecA (secA), partial
MBS1093336 Inquire

Recombinant Streptococcus equi subsp. zooepidemicus Protein translocase subunit SecA (secA), partial

Sign In for Pricing
View Details
CRYL1 Rabbit Polyclonal Antibody
BT-AP08482-01 20 µL

CRYL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CRYL1 Rabbit Polyclonal Antibody
BT-AP08482-02 50 µL

CRYL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CRYL1 Rabbit Polyclonal Antibody
BT-AP08482-03 100 µL

CRYL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details