Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF8 Rabbit Polyclonal Antibody (Biotin)

RASSF8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HOJ1, C12orf2

UniProt

Q8NHQ8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RASSF8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYASDVQLILRRTGPSL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009142

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain (KLC709), 1mg/mL
BNUM0709-50 1x 50 µL

Human Kappa Light Chain (KLC709), 1mg/mL

Sign In for Pricing
View Details
CD8 (C8/468 + C8/144B), CF647 conjugate, 0.1mg/mL
BNC470750-500 1x 500 µL

CD8 (C8/468 + C8/144B), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX2 (Embryonic Stem Cell Marker) (rSOX2/1791), CF640R conjugate, 0.1mg/mL
BNC403648-100 1x 100 µL

SOX2 (Embryonic Stem Cell Marker) (rSOX2/1791), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 NP NTD domain (His Tag)
PKSR030486 1 mg

Recombinant SARS-CoV-2 NP NTD domain (His Tag)

Sign In for Pricing
View Details
S100A2 / S100 Calcium Binding Protein A2 (CPTC-S100A2-2), CF647 conjugate, 0.1mg/mL
BNC472591-500 1x 500 µL

S100A2 / S100 Calcium Binding Protein A2 (CPTC-S100A2-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Polystyrene AM HMPA
H25031515.25G 25 g

Polystyrene AM HMPA

Sign In for Pricing
View Details