Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF8 Rabbit Polyclonal Antibody (FITC)

RASSF8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HOJ1, C12orf2

UniProt

Q8NHQ8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RASSF8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYASDVQLILRRTGPSL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009142

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC nu (PRKD3) Rabbit Polyclonal Antibody
TA359888 100 µL

PKC nu (PRKD3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GCDFP-15, CT (PIP, GCDFP15, GPIP4, Prolactin-inducible protein, Gross cystic disease fluid protein 15, Prolactin-induced protein, Secretory actin-binding protein, gp17)
MBS6003948-01 0.2 mL

GCDFP-15, CT (PIP, GCDFP15, GPIP4, Prolactin-inducible protein, Gross cystic disease fluid protein 15, Prolactin-induced protein, Secretory actin-binding protein, gp17)

Sign In for Pricing
View Details
GCDFP-15, CT (PIP, GCDFP15, GPIP4, Prolactin-inducible protein, Gross cystic disease fluid protein 15, Prolactin-induced protein, Secretory actin-binding protein, gp17)
MBS6003948-02 5x 0.2 mL

GCDFP-15, CT (PIP, GCDFP15, GPIP4, Prolactin-inducible protein, Gross cystic disease fluid protein 15, Prolactin-induced protein, Secretory actin-binding protein, gp17)

Sign In for Pricing
View Details
(+) -DHMEQ
MLA19441-01 10 mg

(+) -DHMEQ

Sign In for Pricing
View Details
(+) -DHMEQ
MLA19441-02 25 mg

(+) -DHMEQ

Sign In for Pricing
View Details
(+) -DHMEQ
MLA19441-03 50 mg

(+) -DHMEQ

Sign In for Pricing
View Details