Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF8 Rabbit Polyclonal Antibody (FITC)

RASSF8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HOJ1, C12orf2

UniProt

Q8NHQ8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human RASF8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RHLAPHENPIISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFPL3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B6]
TA504732AM 100 µL

RFPL3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B6]

Sign In for Pricing
View Details
FBXO42 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]
TA800168BM 100 µL

FBXO42 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]

Sign In for Pricing
View Details
HRP Conjugated Dolichos biflorus Lectin (Horse Gram) -DBA-
H-1201-1 1 mg

HRP Conjugated Dolichos biflorus Lectin (Horse Gram) -DBA-

Sign In for Pricing
View Details
Wide Bore Pipette Tip
P5730 960 Units/Pack

Wide Bore Pipette Tip

Sign In for Pricing
View Details
ViaTagTM 660/680 Haloalkane Ligand, 1000X in DMSO
#10310 1x 30 µL

ViaTagTM 660/680 Haloalkane Ligand, 1000X in DMSO

Sign In for Pricing
View Details
ELAVL4 Antibody
KC-2608-01 50 μL

ELAVL4 Antibody

Sign In for Pricing
View Details